PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010536471.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family Nin-like
Protein Properties Length: 891aa    MW: 99669.3 Da    PI: 6.4499
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010536471.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.62.9e-29574625152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_010536471.1 574 AEKTITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 625
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.393559645IPR003035RWP-RK domain
PfamPF020422.0E-25577625IPR003035RWP-RK domain
SuperFamilySSF542772.7E-24784881No hitNo description
PROSITE profilePS5174529.276793876IPR000270PB1 domain
SMARTSM006665.2E-27793876IPR000270PB1 domain
CDDcd064071.38E-44794874No hitNo description
PfamPF005643.6E-19794875IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.2E-21794873No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 891 aa     Download sequence    Send to blast
MGDNVRQPGN TINAPPMDSA MDIEFMDELL FDGCWLETTD GSEFLNFSPS TTSAPFDPSS  60
FMWSPAQDSA ICGSGLSQMF SQDGAERSGH DEAHWKDIPS LNRRWWIGPR TNPPGVPGSS  120
VTERLVQALK SVKDFTRERG SLIQLWVPVN RGGKRILTTK EQPFSVDPMC HRLANYREIS  180
ESFHFSAEQE DSKDLVGLPG RVFLGKVPEW TPDVRFFRSE EYPRVQHAQD CDVRGTLAIP  240
VFEQGSKACL GVIEIVMTTQ MVKSRFELES ICKALQAVDL RSTEVPIPFP VKVRDLSYQG  300
ALPEIRNLLR CACETHKLPL AQTWVSCLQQ GKGGCRHNDE NYIHCVSTVD DACYVGDVTV  360
QEFHEACSEH HLLKGQGVAG QAFLTNEPCF SPDVTGYKKT EYPLSHHATM FGLHGAVAIR  420
LRCIHTGSAD FVLEFFLPKS CRDLEEQRKM LNSLSTIMAH VPRSLRTVTN KELEEEADSI  480
TSEVTEREET VPKVENVLNE KSSWNPSVTE LQQSNSNPQK LGPMFALGAS EMGKQSEVFE  540
MKRGFDYGGE SSMNESTVSS SGFGRMAEKK RTKAEKTITL DVLRQYFAGS LKDAAKSIGV  600
CPTTLKRICR QHGIQRWPSR KIKKVGHSLQ KIQRVIDSVQ GVSGPLPIGS FYANFPSMAS  660
PKASQAKTFQ PADPAPSALQ HESRVKSPSS SCTQSSSSSQ CCSSETQLNN APTFHKSVTA  720
EDPAIGENSL VDGGAMKKTR SEAEFHSSCL EETQTLSRFQ SHKSFKENPS FENLSRFPET  780
HSAHLPSSQE DDFLRIKVTY EDEKIRFRMR NSCRLKDLLW EIAKRFNMED VTRYDLKYLD  840
DDNEWVLLTC DADVEECIDV CRSSPSHTIK LLLQVSSHHL PERSSASRCH L
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010536471.10.0PREDICTED: protein NLP4-like
RefseqXP_010536472.10.0PREDICTED: protein NLP4-like
RefseqXP_010536473.10.0PREDICTED: protein NLP4-like
RefseqXP_010536474.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGAT1G20640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein